Arabidopsis lyrata (lyrate rockcress): 9314002 Help Entry 9314002           CDS       T01578                                  Name (RefSeq) histone H2B.8   KO K11252   histone H2B Organism aly  Arabidopsis lyrata (lyrate rockcress) Brite KEGG Orthology (KO) [BR:aly00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aly03036]     9314002   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aly04147]     9314002 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Nucleosome assembly factors    Histones     9314002 Exosome [BR:aly04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    9314002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID Motif Other DBs NCBI-GeneID:  9314002 NCBI-ProteinID:  XP_020880339 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MKLTGGDGSFTQKKSKKNIETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQ ESSRLARYNKKPTITSREIQTAVRLVLPGELSKHAVSEGTKAVTKFTS NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaaacttactgggggagacgggtcgttcacccagaagaaatcgaagaagaacatcgag acgtacaagatctacatcttcaaggttttgaagcaagttcatccagatatcggaatctct gggaaagcgatgggaatcatgaacagtttcatcaacgacatcttcgagaaactcgctcag gaatcatcgcgattggctaggtacaacaagaagccgacgatcacttctcgggaaattcag acggcggtgaggcttgtgttgcctggagaactctcgaaacacgctgtttctgaaggcact aaggcggttacaaaattcacctcttag

DBGET integrated database retrieval system