Arabidopsis lyrata (lyrate rockcress): 9323102 Help Entry 9323102           CDS       T01578                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly04016   MAPK signaling pathway - plant aly04070   Phosphatidylinositol signaling system aly04075   Plant hormone signal transduction aly04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aly00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     9323102    04070 Phosphatidylinositol signaling system     9323102    04075 Plant hormone signal transduction     9323102  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     9323102  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aly01009]     9323102   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9323102    03036 Chromosome and associated proteins [BR:aly03036]     9323102   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aly04147]     9323102 Protein phosphatases and associated proteins [BR:aly01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      9323102 Membrane trafficking [BR:aly04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     9323102 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      9323102 Exosome [BR:aly04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    9323102 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg DUF5580_M UPF0154 EF-hand_11 Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand PA_Ig-like PhageMin_Tail DUF1103 Fe_hyd_lg_C MecA_N SurA_N_3 DUF6279 Motif Other DBs NCBI-GeneID:  9323102 NCBI-ProteinID:  XP_002888498 UniProt:  D7KTP8 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVEEMIREADVDGDGQINYEEFVKIMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctaactgatgaacagatctctgagtttaaggaagcttttagcctcttc gacaaagatggagatggttgtatcaccacaaaggagctgggaacagtgatgcggtcacta gggcagaacccaactgaagctgagctacaagacatgatcaacgaggttgacgctgatgga aacggcaccattgacttccctgagttcctaaacctaatggctaagaagatgaaggacaca gactcagaggaagagctgaaagaagccttcagggtgtttgacaaagaccagaacgggttt atatccgctgcagagctgcgccatgtgatgactaatttaggtgagaaactgactgatgaa gaggtcgaggagatgatccgtgaagcagatgttgatggagatggtcagataaactacgag gagtttgtcaagattatgatggctaagtga

DBGET integrated database retrieval system