Arabidopsis lyrata (lyrate rockcress): 9323686 Help Entry 9323686           CDS       T01578                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03083   Polycomb repressive complex aly04120   Ubiquitin mediated proteolysis aly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9323686    04120 Ubiquitin mediated proteolysis     9323686   09126 Chromosome    03083 Polycomb repressive complex     9323686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9323686    04121 Ubiquitin system [BR:aly04121]     9323686    03036 Chromosome and associated proteins [BR:aly03036]     9323686 Membrane trafficking [BR:aly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     9323686 Ubiquitin system [BR:aly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      9323686    Cul7 complex      9323686 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      9323686   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      9323686 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  9323686 NCBI-ProteinID:  XP_020891141 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search MSSKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCK KHVEVAAAKSEAVDGATSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTV ADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgaagaagattgtgttgaagagttccgatggtgaatctttcgaggttgaagag gcggtggctctcgagtcacagaccatagcccacatggttgaagacgactgcgtcgacaac ggagtccctcttcccaacgtcacgagcaagatccttgcgaaggtgatcgagtattgcaag aagcacgtcgaggttgctgccgccaagagcgaggccgtcgatggtgctacctccgatgaa gacctcaaggcctgggacactgagtttatgaagatcgatcaggctacgctctttgaactc attctggctgctaattacctgaacatcaagaacttgcttgacctcacatgtcagacagtg gcggacatgatcaaagggaagactccagaagagatccgcacaacgttcaacatcaagaac gacttcacacccgaggaagaggaagaggtgcgcagagagaaccaatgggcttttgaatga

DBGET integrated database retrieval system