Arabidopsis lyrata (lyrate rockcress): 9326435 Help Entry 9326435           CDS       T01578                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03083   Polycomb repressive complex aly04120   Ubiquitin mediated proteolysis aly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9326435    04120 Ubiquitin mediated proteolysis     9326435   09126 Chromosome    03083 Polycomb repressive complex     9326435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9326435    04121 Ubiquitin system [BR:aly04121]     9326435    03036 Chromosome and associated proteins [BR:aly03036]     9326435 Membrane trafficking [BR:aly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     9326435 Ubiquitin system [BR:aly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      9326435    Cul7 complex      9326435 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      9326435   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      9326435 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  9326435 NCBI-ProteinID:  XP_002890373 UniProt:  D7KI99 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MAAKKIILKSSDGESFEIDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCK KHVEAAAESGGDEDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCK AVADMMRGKTPEQMREHFNIKNDYTPEEEEEVRNENKWAFE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggcagcgaagaagatcatcctcaagagctccgacggtgaatccttcgagatcgatgaa gccgtcgcggtcgagtcccagacgattaagcacatgatcgaggacgactgcgccgataac ggaattccgcttcccaatgttactggagccatccttgcgaaggttattgagtactgcaag aagcacgttgaagccgcggctgagtctggcggagacgaggatttttgtggttccaccgag aacgatgaactcaaggcatgggacaacgacttcgtcaaagttgatcagcctactctcttc gatctcatcctggctgcgaactatttgaacatcagtggacttcttgacctaacgtgcaag gccgtggctgatatgatgagaggaaaaactccagagcagatgcgtgagcacttcaacatc aagaacgattacacacctgaggaagaggaggaggttcgcaatgagaacaagtgggctttc gagtga

DBGET integrated database retrieval system