Arabidopsis lyrata (lyrate rockcress): 9327858 Help Entry 9327858           CDS       T01578                                  Name (RefSeq) ubiquitin-like protein ATG12A   KO K08336   ubiquitin-like protein ATG12 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly04136   Autophagy - other Brite KEGG Orthology (KO) [BR:aly00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     9327858  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9327858    04121 Ubiquitin system [BR:aly04121]     9327858    03029 Mitochondrial biogenesis [BR:aly03029]     9327858 Membrane trafficking [BR:aly04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     9327858 Ubiquitin system [BR:aly04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    9327858 Mitochondrial biogenesis [BR:aly03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     9327858 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  9327858 NCBI-ProteinID:  XP_002891796 UniProt:  D7KM34 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MAMESSSPGSVRKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLRSDSLFVYV NSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgatggagtcgtcgtccccgggctctgttcggaaagttgttgttcatctaagagct actggaggtgctcctatactcaaacaatctaagttcaagattccggggactgataaattt gctaaagtgattgactttctaagaagacagcttcgttctgactcattgtttgtctatgtc aatagtgctttctcgccaaaccctgatgaatcagtcattgatctttataataactttgga tttgatggtaaactggtggttaactatgcttgttccatggcatggggctaa

DBGET integrated database retrieval system