Anaplasma marginale St. Maries: AM339 Help Entry AM339             CDS       T00216                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ama  Anaplasma marginale St. Maries Pathway ama01100   Metabolic pathways ama01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ama00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AM339 (acpP)    00074 Mycolic acid biosynthesis     AM339 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AM339 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AAV86421 LinkDB All DBs Position complement(288627..288974) Genome browser AA seq 115 aa AA seqDB search MRFWHGPWFLFLVYGCVMEGGEVGNLKSDDAVLEDIKSKVMEAVIGCLKLKDEQKQVLSG TTNLAKDFNLDSLDFVDLIMSLEEKFSIEITDEEAQGLETVDDICKYIHGKSKSE NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gtgcggttctggcacggtccgtggtttctgtttttagtttatgggtgcgtcatggaaggt ggtgaggtagggaacttgaagtctgacgatgctgttttggaagacatcaaatctaaggtc atggaggccgtgattggctgtctaaaattgaaggatgagcagaagcaggttctttctggg actaccaacctggccaaggatttcaacctggatagcctggattttgtggatctgattatg tccctggaggagaagttctccatagagattaccgacgaggaggcgcagggattggaaacc gtagatgatatatgtaaatacatacatggcaaatctaagtctgagtag

DBGET integrated database retrieval system