KEGG   Anaplasma marginale St. Maries: AM784
Entry
AM784             CDS       T00216                                 
Symbol
petA
Name
(GenBank) cytochrome B6-F complex iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00190  Oxidative phosphorylation
ama01100  Metabolic pathways
ama02020  Two-component system
Module
ama_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM784 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AM784 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    AM784 (petA)
Enzymes [BR:ama01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     AM784 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: AAV86719
LinkDB
Position
complement(716373..716897)
AA seq 174 aa
MKRRDFLGLTTLSMACMGAASFVYPLVESLNPSADVMAHATIEVDLSGIKEGSTKVVKWQ
GKPVFIRRRTAEEIEDARAVNVADLRDPQSDQQRTRQESGEWLIVLGICTHLGCVPVEVK
DGTKGWYCPCHGSKYDTSGRVVAGPAPLNLSVPDYYFPDDSTVVIGKKSAESTV
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaagcgtagggactttttgggccttaccacgctctctatggcgtgcatgggggcggcg
tctttcgtgtatcctctggttgagtctctcaacccgtctgcagatgtaatggctcatgct
acgattgaggtggatctatctggcatcaaggagggtagcaccaaggttgttaagtggcag
gggaagccggttttcatacgcaggcggactgcggaggaaatagaagatgctagagcggtt
aatgttgcggacctgcgtgatccgcaaagtgaccaacaacgcacccgtcaagagagcggc
gaatggctaattgtgctgggcatttgtacacatttgggttgtgtgcccgtggaagtgaag
gatggcacgaaggggtggtactgtccgtgtcacggttctaaatacgatacatctggtagg
gtggttgcgggtccggcgccgcttaatctttctgtgcctgattactacttccccgatgat
agcaccgtcgtgatcggaaagaagagcgctgagtctactgtgtag

DBGET integrated database retrieval system