Alteromonas mediterranea U7: I876_18100 Help Entry I876_18100        CDS       T02721                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism amae  Alteromonas mediterranea U7 Pathway amae02024   Quorum sensing amae03018   RNA degradation Brite KEGG Orthology (KO) [BR:amae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     I876_18100  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     I876_18100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:amae03019]     I876_18100    03036 Chromosome and associated proteins [BR:amae03036]     I876_18100 Messenger RNA biogenesis [BR:amae03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      I876_18100 Chromosome and associated proteins [BR:amae03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     I876_18100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AGP91452 LinkDB All DBs Position complement(4119225..4119473) Genome browser AA seq 82 aa AA seqDB search MAKGQSLQDPFLNALRKERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPARAITMPSAGDSENTKGE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctaaagggcaatctttacaagacccattcttaaacgctttgcgtaaggaacgtata ccagtatcaatttatctggtaaacggtatcaaacttcaggggcaggttgagtcattcgac cagttcgttattctactgaagaacacagtaagccaaatggtgtataagcacgcaatttct actgttgttccagcacgcgctatcacaatgccaagcgcaggagattctgaaaatactaaa ggtgaataa

DBGET integrated database retrieval system