KEGG   Acidianus manzaensis: B6F84_07125
Entry
B6F84_07125       CDS       T04836                                 
Name
(GenBank) tRNA pseudouridine synthase A
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
aman  Acidianus manzaensis
Brite
KEGG Orthology (KO) [BR:aman00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aman03016]
    B6F84_07125
Enzymes [BR:aman01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     B6F84_07125
Transfer RNA biogenesis [BR:aman03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    B6F84_07125
 Prokaryotic type
    B6F84_07125
SSDB
Motif
Pfam: DKCLD TruB_N
Other DBs
NCBI-ProteinID: ARM75829
UniProt: A0A1W6JZY8
LinkDB
Position
complement(1481322..1481576)
AA seq 84 aa
MDFYPFIYKIDEYCKYKNNWNIRKEAQTSENIGFFPDKRDITLLIKNSIINIDKPAGPTS
HEVAFWIKQMFKVNKVGHGGTLEP
NT seq 255 nt   +upstreamnt  +downstreamnt
atggatttttatccatttatatataagatagatgaatactgtaaatacaaaaataattgg
aatataagaaaagaagctcaaacgtctgaaaatataggtttttttccagataaacgcgat
attactcttctaattaagaactctataataaatattgataaaccagcaggcccaacaagc
catgaagtagcattttggataaaacaaatgtttaaagtaaataaagtaggtcatggaggg
accctagagccttaa

DBGET integrated database retrieval system