Anopheles maculipalpis: 126556383 Help Entry 126556383         CDS       T10890                                  Name (RefSeq) bombyxin F-1-like   KO K04526   insulin Organism amap  Anopheles maculipalpis Pathway amap04068   FoxO signaling pathway amap04081   Hormone signaling amap04140   Autophagy - animal amap04150   mTOR signaling pathway amap04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:amap00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     126556383    04150 mTOR signaling pathway     126556383   09133 Signaling molecules and interaction    04081 Hormone signaling     126556383  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126556383  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     126556383  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amap04052]     126556383 Cytokines and neuropeptides [BR:amap04052]  Neuropeptides   Unclassified    126556383 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  126556383 NCBI-ProteinID:  XP_050067606 LinkDB All DBs Position 2RL:complement(68626712..68635667) Genome browser AA seq 131 aa AA seqDB search MRSTCVGMNSVLIVAVVVLLLLNESKATSTPNSDALISQLTRSRYCGRRLTETLAFLCQG RYPMLTHYRTDYVHDQQRVKVEVATLPDTLPPGFPYPGAGVHRRSRRSSGGIYDECCKKS CSYVELRAYCD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgcgatccacctgtgtcggtatgaattccgtcctaatcgtcgcggtggttgtgctgttg ctgctgaacgaaagtaaagcgacctccacaccgaacagcgatgcgttgatcagccaactg actcgctcacgctactgcggccgtcgccttacggagacgcttgccttcctctgccaggga cgatatccgatgttaacccactaccgaaccgattacgtccacgatcagcagcgggtaaag gtggaggtagccacactgcctgatacactgccgcccggcttcccatatcctggggccggc gtgcatcgacgcagtcggcgcagttccggcggtatctacgatgagtgctgcaagaagagc tgctcctacgtcgagctgcgagcgtactgtgattga

DBGET integrated database retrieval system