Anopheles maculipalpis: 126559451 Help Entry 126559451         CDS       T10890                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism amap  Anopheles maculipalpis Pathway amap04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:amap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126559451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amap04121]     126559451    03400 DNA repair and recombination proteins [BR:amap03400]     126559451 Ubiquitin system [BR:amap04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126559451    Cul5 complex      126559451 DNA repair and recombination proteins [BR:amap03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126559451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  126559451 NCBI-ProteinID:  XP_050071570 LinkDB All DBs Position 2RL:15770896..15808109 Genome browser AA seq 117 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVYELKKMIEGILKVPPRDQRLYNKDNMLMDDDKTLQD CGITVVTAKAQCPAQLGLAIRENGDFESLELTPYSLPPDLPDVMKNQDTANGQDQLA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttatgatgatccggcggaagaagacaacgattttcaccgatgccaaagag acgacgccggtgtacgagctgaagaaaatgatcgaaggaatactcaaagtgcctccccgc gatcagcgactatacaacaaagacaacatgctaatggacgacgataaaacgctgcaggat tgcgggatcacggtcgtgacggcgaaagcgcaatgtcccgcccagcttggtttagccata cgcgaaaacggcgattttgaatcgctcgagctgacgccctactcgttgccacccgatcta ccggatgtgatgaaaaaccaggacaccgcaaatggccaagatcaactcgcctaa

DBGET integrated database retrieval system