Algicella marina: GO499_04725 Help Entry GO499_04725       CDS       T08414                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amaq  Algicella marina Pathway amaq01100   Metabolic pathways amaq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amaq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GO499_04725    00074 Mycolic acid biosynthesis     GO499_04725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GO499_04725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QHQ34543 UniProt:  A0A6P1SYV1 LinkDB All DBs Position 955820..956053 Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLNVEEAKVVESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgtgtgaaaaagatcgtggtcgagcacctgaacgtggaagaa gccaaagttgtcgaaagtgcttccttcatcgacgatctgggcgctgacagcctcgacacc gtggaactggtgatggcattcgaagaggaattcggcatcgagatcccggatgacgcggcc gagacgattcagacgttcggcgatgccgtgaagttcatctccgaagcggcctga

DBGET integrated database retrieval system