KEGG   Algicella marina: GO499_05175
Entry
GO499_05175       CDS       T08414                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
amaq  Algicella marina
Pathway
amaq00190  Oxidative phosphorylation
amaq01100  Metabolic pathways
Module
amaq_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amaq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GO499_05175
Enzymes [BR:amaq01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     GO499_05175
SSDB
Motif
Pfam: Oxidored_q3
Other DBs
NCBI-ProteinID: QHQ34625
UniProt: A0A6P1SYM4
LinkDB
Position
1033794..1034408
AA seq 204 aa
MGFAAFAFYMFSLVACVAGVLVVVSKNPVHSVLWLILAFFSSAGLFVLLGAEFVAMLLVI
VYVGAVAVLFLFVVMMLDVDFAELRGELSRYTPIGLLIGVVIVMQLMFAFGSWELDDASQ
AARGAVAPAPEELQNTAALGQLIYTKYILLFQTAGLVLFVAMVGAIVLTLRHKPNVKRQD
ILAQIYRDPAKSVDLVDVKPGQGL
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggctttgcagccttcgcgttctacatgttctcgctggtcgcctgtgtggcgggggtg
ctggtcgtcgtttccaagaacccggtgcattcggtgctgtggctgatccttgccttcttc
tcctccgccgggctgtttgtgctgttgggcgcggagttcgtggcgatgttgctggtgatc
gtctacgtcggcgcggtggcggtgctgttcctgttcgtggtgatgatgctggacgttgat
ttcgcggaattgcgtggcgagctgagcaggtatacccccatcgggctgctgatcggggtg
gtcatcgtgatgcagttgatgttcgccttcggctcgtgggaattggacgacgcatcgcag
gctgcgcgtggcgcggtggcgccggcgccggaagagttgcagaacaccgcggcgttgggt
cagttgatctacacgaagtacatcctgctgttccagacggcggggctggtgctgtttgtc
gccatggtcggtgccattgtcctgacgctgcgccacaagccgaatgtgaagcggcaggac
atccttgcccagatctaccgcgacccggcgaagagtgtcgatttggtggacgtgaagccg
gggcaggggctgtga

DBGET integrated database retrieval system