Algicella marina: GO499_08320 Help Entry GO499_08320       CDS       T08414                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amaq  Algicella marina Pathway amaq01100   Metabolic pathways amaq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amaq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GO499_08320    00074 Mycolic acid biosynthesis     GO499_08320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GO499_08320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  QHQ35205 UniProt:  A0A6P1T0A4 LinkDB All DBs Position complement(1667512..1667778) Genome browser AA seq 88 aa AA seqDB search MAGSVADKVIAIIAEQAVLEPEEVTPEATLEELGLDSLGLVEAIFAIEEQFDISVPFNAN DPAQSEFDISNVRSMVTAVESLIAKKNA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcgggctccgttgctgacaaggttatcgcaatcattgctgagcaggctgtcctggag ccggaagaggtgactcctgaggcgacgctggaagaactcgggctcgacagccttgggctg gtggaggcgatcttcgcgatcgaggagcagttcgacatctccgtaccgttcaacgccaac gatccggcgcaatccgagttcgacatttcgaatgtgcgctcaatggtgacggcggtggaa tcgcttattgcgaaaaagaacgcctga

DBGET integrated database retrieval system