Algicella marina: GO499_16425 Help Entry GO499_16425       CDS       T08414                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism amaq  Algicella marina Brite KEGG Orthology (KO) [BR:amaq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:amaq03032]     GO499_16425    03036 Chromosome and associated proteins [BR:amaq03036]     GO499_16425    03400 DNA repair and recombination proteins [BR:amaq03400]     GO499_16425 DNA replication proteins [BR:amaq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GO499_16425 Chromosome and associated proteins [BR:amaq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GO499_16425 DNA repair and recombination proteins [BR:amaq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GO499_16425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 SctB2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QHQ36645 UniProt:  A0A6P1T4G8 LinkDB All DBs Position complement(3348468..3348758) Genome browser AA seq 96 aa AA seqDB search MAQKPMTKTQLVAALAEKTDSDKTTANSMLAALTEIVTDEVAAGGAVTLPGLGKFACRER PARMVRNPATGEQVHKDADRVAKVTIAKALKDVINA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcccagaaaccaatgacaaaaactcagctcgttgccgcgctggcggaaaagaccgat agcgacaagacgacagcaaattcgatgctcgccgctctcaccgagatcgtgactgacgaa gtagcagccggtggcgcagtgacgctgcccggacttggcaaattcgcctgccgtgagcgc ccggcgcgcatggttcggaaccccgccacgggcgagcaggttcacaaggacgccgaccgc gttgccaaggtaacgattgccaaggctctgaaagacgtcatcaacgcctga

DBGET integrated database retrieval system