Agromyces marinus: DSM26151_14040 Help Entry DSM26151_14040    CDS       T08161                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism amau  Agromyces marinus Pathway amau01100   Metabolic pathways amau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM26151_14040 (acpP)    00074 Mycolic acid biosynthesis     DSM26151_14040 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM26151_14040 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UIP58527 LinkDB All DBs Position complement(1497565..1497813) Genome browser AA seq 82 aa AA seqDB search MASTRDEVLAGLAELINDETGIATDTVEADKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVDFIVNAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcatcgacccgcgacgaagtgcttgccggcctggctgagctcatcaacgacgagacc ggcatcgccaccgacacggtcgaggcggacaagtcgttcaccgacgacctcgacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtcaagatcccc gacgaagaggtcaagaacctcaagaccgtcggcgacgccgtcgacttcatcgtcaacgcg caggcctag

DBGET integrated database retrieval system