Agromyces mangrovi: GCM10025877_32330 Help Entry GCM10025877_32330 CDS       T09181                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amav  Agromyces mangrovi Pathway amav01100   Metabolic pathways amav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GCM10025877_32330 (acpP)    00074 Mycolic acid biosynthesis     GCM10025877_32330 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GCM10025877_32330 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BDZ66295 LinkDB All DBs Position complement(3353427..3353675) Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVGYIVKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctggccggcctggccgagctcatcaacgacgagacc ggcatcgcgaccgacacggtcgagctggacaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgaccatcgtggtcaacgccgaggagaagttcgacgtgaagatcccc gacgaggaggtcaagaacctcaagaccgtcggcgacgccgtcggctacatcgtcaaggcc caggcctag

DBGET integrated database retrieval system