Ahrensia marina: ABWH92_00670 Help Entry ABWH92_00670      CDS       T10849                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism amax  Ahrensia marina Brite KEGG Orthology (KO) [BR:amax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:amax03110]     ABWH92_00670 (groES)    03029 Mitochondrial biogenesis [BR:amax03029]     ABWH92_00670 (groES) Chaperones and folding catalysts [BR:amax03110]  Heat shock proteins   HSP10    ABWH92_00670 (groES) Mitochondrial biogenesis [BR:amax03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ABWH92_00670 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  XHC41887 LinkDB All DBs Position 132794..133081 Genome browser AA seq 95 aa AA seqDB search MAFRPLHDRVVVRRIDSDEKTAGGIIIPDTAKEKPQEGEIVSVGPGARDDAGKVQALDVK AGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGVIA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcattccgtcccttgcatgaccgtgtggtggtgcgtcgcatcgattccgatgagaaa actgccggagggatcatcattcccgacaccgcaaaagagaaaccacaggaaggcgaaatc gtctctgtaggccctggcgcacgcgatgatgctggcaaagttcaggctttggacgtcaaa gctggcgaccgcgttctgttcggcaaatggtccggcaccgaagtgaagatcgacggtgaa gacctgctgatcatgaaggaaagcgacatcatgggtgtgatcgcctaa

DBGET integrated database retrieval system