Actinomadura madurae: LUW76_11715 Help Entry LUW76_11715       CDS       T08933                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amaz  Actinomadura madurae Pathway amaz00998   Biosynthesis of various antibiotics amaz01100   Metabolic pathways amaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amaz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LUW76_11715    00074 Mycolic acid biosynthesis     LUW76_11715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LUW76_11715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  URM94940 LinkDB All DBs Position 2514682..2514936 Genome browser AA seq 84 aa AA seqDB search MADVATEQQILDGLAEIIDEIVGIDKSEVTPEKNFIDDLDIDSLSMVEIAVAAQDQFGVE IPDDELRNLKTVKDVVNFVQNLQS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtcgccaccgaacagcagatcctggacggcctcgccgagatcatcgacgag atcgtcggcatcgacaagtccgaggtcaccccggagaagaacttcatcgacgatctcgac atcgactcgctgtcgatggtggagatcgccgtcgccgcgcaggaccagttcggcgtcgag atccccgacgacgagctgcgcaacctgaagacggtcaaggacgtcgtcaacttcgtccag aacctccagagctga

DBGET integrated database retrieval system