Actinomadura madurae: LUW76_46585 Help Entry LUW76_46585       CDS       T08933                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism amaz  Actinomadura madurae Pathway amaz01051   Biosynthesis of ansamycins amaz01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:amaz00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     LUW76_46585    01051 Biosynthesis of ansamycins     LUW76_46585  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:amaz01008]     LUW76_46585 Polyketide biosynthesis proteins [BR:amaz01008]  Polyketide tailoring proteins   Others    LUW76_46585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  URN01181 LinkDB All DBs Position 9814179..9814454 Genome browser AA seq 91 aa AA seqDB search MTTEQNAESIEQELLAFLEERIGDPVSPTQELFASGLASSMFAMELVVHLEKTYGIAIVG SDLKLDNFRTVRIMTELVGRLRATSAVVGGD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacgaccgaacagaacgccgaatcaatcgagcaggagctgctggctttcctggaggaa aggatcggtgacccggtctcgccgacgcaggaactcttcgcctccggccttgcgtcctcg atgttcgccatggaactcgtcgtccaccttgagaagacctacgggatcgccatcgtcggc tccgacctcaagctggacaacttccggacagtgcggatcatgacggaactggtgggcagg ctccgcgccacgtccgcggtggtgggtggtgactga

DBGET integrated database retrieval system