Amycolatopsis mediterranei U32: AMED_2100 Help Entry AMED_2100         CDS       T01269                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amd  Amycolatopsis mediterranei U32 Pathway amd00998   Biosynthesis of various antibiotics amd01100   Metabolic pathways amd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMED_2100 (acpP)    00074 Mycolic acid biosynthesis     AMED_2100 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMED_2100 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ADJ43906 UniProt:  A0A0H3D2Y9 LinkDB All DBs Position complement(2244048..2244293) Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVNYVSANSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacgctgagatcctcgccggcctcgccgagatcgtcgaagaggtcgccggt gtggctcaggacgacgtcaccgccgagaagtcgttcgtggacgacctggacatcgactcg ctgtcgatggtcgagatcgccgtgcaggccgaggacaagttcggcgtcaagatcccggac gacgagctcgccaacctcaagaccgtgggcgacgcggtgaactacgtgtcggccaactcg aagtaa

DBGET integrated database retrieval system