Amycolatopsis mediterranei U32: AMED_7552 Help Entry AMED_7552         CDS       T01269                                  Symbol soxD Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism amd  Amycolatopsis mediterranei U32 Pathway amd00260   Glycine, serine and threonine metabolism amd01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:amd00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     AMED_7552 (soxD) Enzymes [BR:amd01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      AMED_7552 (soxD)     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      AMED_7552 (soxD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev F-box_5 Motif Other DBs NCBI-ProteinID:  ADJ49265 UniProt:  A0A0H3DED6 LinkDB All DBs Position complement(8343466..8343744) Genome browser AA seq 92 aa AA seqDB search MQLIPCPWCGPREEAEFHYGGQAHVAYPADPSAMPDEEWAKFVFFRDNPSGPFAERWSHS AGCRRWFNAVRDTRTHDLLAVYRLDEPRPVIS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcaactgatcccctgcccgtggtgcgggccgcgtgaggaagccgagttccactacggc ggccaggcgcacgtcgcctatccggccgacccgtcggcgatgccggacgaagaatgggcg aagttcgtcttcttccgcgacaacccgagcggcccgttcgccgagcgctggagccactcc gcggggtgccgccggtggttcaacgccgtccgcgacacccgcacccacgacctcctggcg gtctaccgcctcgacgagccccggccggtgatctcatga

DBGET integrated database retrieval system