Apis mellifera (honey bee): 551511 Help Entry 551511            CDS       T01057                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ame  Apis mellifera (honey bee) Pathway ame04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ame00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     551511  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ame04121]     551511    03400 DNA repair and recombination proteins [BR:ame03400]     551511 Ubiquitin system [BR:ame04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      551511    Cul5 complex      551511 DNA repair and recombination proteins [BR:ame03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      551511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Lin1244_N Motif Other DBs NCBI-GeneID:  551511 NCBI-ProteinID:  XP_623908 BEEBASE:  GB53171 UniProt:  A0A7M7TFQ0 LinkDB All DBs Position LG4:complement(2836827..2839141) Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKISPVNQQLFNKDNVLMSDSKFLSD YGLTSATAKPQCPALVGLAIRQDNGQFEPLEMTPFSLPPDLPDVMKSQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcgacgaaaaaatatgacaatatttactgatgccaaggat aatactacagttcttgagcttaaaaaaattatagaaggtattttgaaaatatcacctgtg aatcaacagctgttcaacaaggataatgttcttatgtcagatagtaaatttttatctgat tatggattaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctata cgtcaagataatggtcaattcgaacctttagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaaactaatggacaagaacaatcaccttga

DBGET integrated database retrieval system