Apis mellifera (honey bee): 551554 Help Entry 551554            CDS       T01057                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ame  Apis mellifera (honey bee) Pathway ame04013   MAPK signaling pathway - fly ame04145   Phagosome ame04148   Efferocytosis ame04310   Wnt signaling pathway ame04620   Toll-like receptor signaling pathway ame05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ame00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     551554    04310 Wnt signaling pathway     551554  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     551554    04148 Efferocytosis     551554  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     551554  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     551554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ame04131]     551554   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     551554    04031 GTP-binding proteins [BR:ame04031]     551554 Membrane trafficking [BR:ame04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     551554  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     551554   Macropinocytosis    Ras GTPases     551554  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     551554 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    551554   Exosomal proteins of other body fluids (saliva and urine)    551554   Exosomal proteins of colorectal cancer cells    551554   Exosomal proteins of bladder cancer cells    551554 GTP-binding proteins [BR:ame04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     551554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  551554 NCBI-ProteinID:  XP_623951 BEEBASE:  GB45558 UniProt:  A0A7M7TFV6 LinkDB All DBs Position LG9:1574656..1577281 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctattaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctt ataagctatactaccaatgcctttcctggagaatatattccaactgtatttgataattat tctgcaaatgtcatggtggatggtaaaccaataaatcttggtttatgggatacagcaggt caagaagattatgacagattaagaccattgtcttatcctcaaacagatgtttttttgatc tgcttttctctcgttaacccagccagttttgaaaatgttcgtgcaaaatggtatccagaa gtacgtcatcattgtccagctactccaattattttagtaggaactaaattagatttacgc gaagataaagaaacaattgagcgattaaaagataagaaacttgcaccaataacatatcct cagggtttatccatggcaaaagaaattggtgctgtaaaatatttagaatgttcggctctt actcaaaaaggattaaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system