Apis mellifera (honey bee): 724279 Help Entry 724279            CDS       T01057                                  Name (RefSeq) cdc42 homolog isoform X1   KO K04393   cell division control protein 42 Organism ame  Apis mellifera (honey bee) Pathway ame04144   Endocytosis ame04517   IgSF CAM signaling ame04518   Integrin signaling ame05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ame00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     724279    04518 Integrin signaling     724279  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     724279  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     724279  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ame04131]     724279    03036 Chromosome and associated proteins [BR:ame03036]     724279   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     724279    04031 GTP-binding proteins [BR:ame04031]     724279 Membrane trafficking [BR:ame04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     724279  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     724279   Macropinocytosis    Ras GTPases     724279 Chromosome and associated proteins [BR:ame03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     724279 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of microglial cells    724279   Exosomal proteins of breast milk    724279 GTP-binding proteins [BR:ame04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     724279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  724279 NCBI-ProteinID:  XP_026301958 BEEBASE:  GB50631 UniProt:  A0A7M7MW98 LinkDB All DBs Position LG1:complement(14019196..14021553) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DDAATIEKLAKNKQKPISAEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVRRRRCIVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactattaaatgcgttgtagttggagatggtgcagtaggtaaaacatgtctgttg atttcatatactaccaataagtttccatccgaatatgttccaacagtatttgacaattat gctgtaactgttatgattggtggtgaaccatatactttaggattatttgatacagcaggt caagaagattatgaccgattacgtcctttgagttatcctcaaactgacgtatttcttgtt tgtttttcggttgtatctccatcatcttttgaaaatgttaaggaaaagtgggttccagaa ataactcatcattgccaaaaaactccatttttgctagttggtactcaaattgatttgaga gatgatgcagcaactattgaaaaacttgcaaaaaataaacaaaagcctatatcggctgaa caaggtgaaaaactcgccaaggaactcaaagcagtgaaatatgtggaatgtagtgctctt acacaaaaaggtttaaaaaacgtattcgacgaagcaattttagcagcattagaacctcca gaaccagttagaagaagacgatgtattgttttgtag

DBGET integrated database retrieval system