Apis mellifera (honey bee): 725344 Help Entry 725344            CDS       T01057                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism ame  Apis mellifera (honey bee) Brite KEGG Orthology (KO) [BR:ame00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ame03036]     725344   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     725344 Chromosome and associated proteins [BR:ame03036]  Eukaryotic type   Nucleosome assembly factors    Histones     725344 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    725344 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 DUF1931 Motif Other DBs NCBI-GeneID:  725344 NCBI-ProteinID:  XP_003251626 UniProt:  A0A7M7LKA7 LinkDB All DBs Position LG1:15879931..15880843 Genome browser AA seq 123 aa AA seqDB search MPPKASGKAVKKAGKAQKNISKSDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT SSK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgccacctaaagcaagcggaaaagctgtgaagaaagctggtaaagctcagaagaatatt agcaagtctgataagaaaaagaagaggaggaggaaggaaagttatgctatttacatctac aaggtgttgaagcaagttcatcctgatactggaatttccagtaaagccatgagcatcatg aacagctttgtaaatgatgtttttgagcgtattgcggccgaagcttcacgtttagcacat tacaacaagagatctaccatcacttctcgggaaatccaaactgctgtcaggcttctgttg cctggtgaattggctaaacacgctgtttctgagggtactaaagccgtcaccaagtacacc agttcaaaataa

DBGET integrated database retrieval system