Apis mellifera (honey bee): 725450 Help Entry 725450            CDS       T01057                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ame  Apis mellifera (honey bee) Pathway ame03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:ame00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     725450  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ame03036]     725450   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     725450 Chromosome and associated proteins [BR:ame03036]  Eukaryotic type   Nucleosome assembly factors    Histones     725450 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    725450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  725450 NCBI-ProteinID:  XP_001120346 BEEBASE:  GB47507 UniProt:  A0A7M7FXW7 LinkDB All DBs Position LG1:15889699..15890243 Genome browser AA seq 124 aa AA seqDB search MSGRGKGGKIKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaaaggtggaaaaattaaaggaaaggcaaaatctcgatcaaataga gcaggcttgcaatttcctgttggccgaatacatagattacttcgtaaaggcaactacgca gaacgtgttggtgctggtgcacctgtttacttggcagctgttatggaatatttggctgct gaagttttagaattggctggaaatgcagccagagataataaaaagactaggattattcca cggcatttacaacttgctatcaggaatgacgaggagctgaacaaacttttatctggagtt acaattgcacaaggtggtgttctgcctaatattcaagcagttttattgcctaaaaaaact gagaaaaaagcataa

DBGET integrated database retrieval system