Apis mellifera (honey bee): 727327 Help Entry 727327            CDS       T01057                                  Symbol Tom7 Name (RefSeq) translocase of outer membrane 7   KO K17771   mitochondrial import receptor subunit TOM7 Organism ame  Apis mellifera (honey bee) Pathway ame04137   Mitophagy - animal Brite KEGG Orthology (KO) [BR:ame00001]  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     727327 (Tom7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ame04131]     727327 (Tom7)    03029 Mitochondrial biogenesis [BR:ame03029]     727327 (Tom7)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ame02000]     727327 (Tom7) Membrane trafficking [BR:ame04131]  Autophagy   Mitophagy    Other mitophagy associated  proteins     727327 (Tom7) Mitochondrial biogenesis [BR:ame03029]  Mitochondrial protein import machinery   Outer membrane    Transporter outer membrane (TOM) complex     727327 (Tom7) Transporters [BR:ame02000]  Other transporters   Primary active transporters [TC:3]    727327 (Tom7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tom7 Motif Other DBs NCBI-GeneID:  727327 NCBI-ProteinID:  NP_001155870 BEEBASE:  GB41686 UniProt:  A0A7M6UD64 LinkDB All DBs Position LG14:complement(10486160..10486552) Genome browser AA seq 54 aa AA seqDB search MAMCPRTKQKVAIILDVSKAIFHWGFIPAILFLGFRKGADPGMPQLSIINLLWQ NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atggcgatgtgtccgcgtacaaagcaaaaagttgctattattttggatgtgagcaaagct atatttcattggggatttattcccgctatattattcttaggctttaggaaaggtgctgat ccaggcatgcctcaattatcaattataaacttattgtggcaataa

DBGET integrated database retrieval system