Aeromonas media: B224_5729 Help Entry B224_5729         CDS       T03075                                  Name (GenBank) transcriptional regulator   KO K09892   cell division protein ZapB Organism amed  Aeromonas media Brite KEGG Orthology (KO) [BR:amed00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:amed03036]     B224_5729 Chromosome and associated proteins [BR:amed03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     B224_5729 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 DUF2046 TSC22 NET2A HR1 Nuf2_DHR10-like Uso1_p115_C BicD K-box ADIP Mod_r NUDE_C DUF7603 GAS TolA_bind_tri Herpes_UL6 Spectrin XRCC4_CC DivIC CCDC113_CCDC96_CC HALZ CCDC138_cc DUF244 TMF_TATA_bd Cep57_MT_bd DUF6262 Sipho_Gp157 MSP1_C DUF2203 FliT APG6_N CtIP_N Spc24 bZIP_1 FlaC_arch Spc7 AKNA bZIP_2 Prominin DUF2205 Motif Other DBs NCBI-ProteinID:  AHX63381 LinkDB All DBs Position 4477797..4478012 Genome browser AA seq 71 aa AA seqDB search MHMSLEVLEQLESKVQSAVDNISLLKMELDELKEQNNKLQDENHQLRNEHVAWQERLRAL LGKMDQMGDAI NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgcatatgtcactagaagtccttgagcaactcgaatccaaagtacaatccgccgtcgac aacatctctctgctgaaaatggagctggacgagctgaaagagcagaacaacaagctgcaa gacgagaaccatcagctgcgcaacgaacacgttgcctggcaggaacgtctgcgcgccctg ctgggcaagatggaccagatgggcgatgccatctga

DBGET integrated database retrieval system