Anopheles merus: 121590048 Help Entry 121590048         CDS       T08889                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism amer  Anopheles merus Pathway amer04013   MAPK signaling pathway - fly amer04068   FoxO signaling pathway amer04137   Mitophagy - animal amer04140   Autophagy - animal amer04150   mTOR signaling pathway amer04213   Longevity regulating pathway - multiple species amer04214   Apoptosis - fly amer04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:amer00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     121590048    04068 FoxO signaling pathway     121590048    04150 mTOR signaling pathway     121590048  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121590048    04137 Mitophagy - animal     121590048   09143 Cell growth and death    04214 Apoptosis - fly     121590048  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     121590048   09149 Aging    04213 Longevity regulating pathway - multiple species     121590048  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amer04131]     121590048   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:amer04031]     121590048 Membrane trafficking [BR:amer04131]  Endocytosis   Macropinocytosis    Ras GTPases     121590048 GTP-binding proteins [BR:amer04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121590048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  121590048 NCBI-ProteinID:  XP_041765326 UniProt:  A0A182VM02 LinkDB All DBs Position 2R:21557201..21563359 Genome browser AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMNQARDVAKQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKERGKKNRKHHKLV SSRRFKCQLL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaaactagtggtagtaggcgctggaggtgtcggcaagtcggcactgacc atacagcttattcagaaccatttcgtagatgagtacgatccgacaattgaagattcctac cggaagcaagtagttatagatggcgaaacgtgtttgctggacattctggacacagccggt caggaggagtattccgcgatgcgtgatcagtatatgcgaacgggtgaaggatttctgcta gtatttgctgttaacagtgccaaaagtttcgaagatataggaacctaccgagaacagatt aagcgcgttaaagacgcagaagaggtgccgatggtgttagttggcaacaagtgcgacctg caagcgtgggcagtggatatgaaccaggccagagatgtggcgaaacagtacggtgtcccg tttgtagaaacctccgccaaaacacggatgggcgtcgacgacgcgttctacacgctagtg cgcgaaatccgcaaagacaaagagagggggaagaagaatcgaaagcaccacaaactggtc tccagcagacgattcaagtgccagctgctataa

DBGET integrated database retrieval system