Anopheles merus: 121592558 Help Entry 121592558         CDS       T08889                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism amer  Anopheles merus Pathway amer04013   MAPK signaling pathway - fly amer04145   Phagosome amer04148   Efferocytosis amer04310   Wnt signaling pathway amer04620   Toll-like receptor signaling pathway amer05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:amer00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     121592558    04310 Wnt signaling pathway     121592558  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121592558    04148 Efferocytosis     121592558  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121592558  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121592558  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amer04131]     121592558   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amer04147]     121592558    04031 GTP-binding proteins [BR:amer04031]     121592558 Membrane trafficking [BR:amer04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121592558  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121592558   Macropinocytosis    Ras GTPases     121592558  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121592558 Exosome [BR:amer04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121592558   Exosomal proteins of other body fluids (saliva and urine)    121592558   Exosomal proteins of colorectal cancer cells    121592558   Exosomal proteins of bladder cancer cells    121592558 GTP-binding proteins [BR:amer04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121592558 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  121592558 NCBI-ProteinID:  XP_041770069 UniProt:  A0A182VF71 LinkDB All DBs Position 2L:complement(20741105..20748994) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKCNIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgtcgtcgtcggtgacggtgccgtcggtaagacgtgcctgctg atcagctacacaacgaacgcatttccgggcgagtacatcccgaccgtgttcgacaactac tccgcgaacgtgatggtcgacggcaaaccgatcaacctcgggctgtgggatacggccggg caggaggattacgatcggctgcggcccctgtcctacccgcagacggacgtgtttctcata tgcttctcgctcgtcaatccggcctcgttcgagaacgtgcgggcgaaatggtacccggag gtgcgccaccactgtccgaacataccgatcatactggtcgggacgaagctcgatctgcga gatgacaagaacacggtggacaagttgcgggacaagaagctgtcgccgatcacgtacccg caggggctggccatggccaaggagatcggtgcggtcaagtacctcgagtgttcggcgctg acgcagaagggcctcaagacggtgttcgacgaagcgatccgggcggtgctctgtccgatg attccgccgaagaagaaacccaagtgtaacatcctctaa

DBGET integrated database retrieval system