Anopheles merus: 121602020 Help Entry 121602020         CDS       T08889                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism amer  Anopheles merus Brite KEGG Orthology (KO) [BR:amer00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:amer03036]     121602020   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amer04147]     121602020 Chromosome and associated proteins [BR:amer03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121602020 Exosome [BR:amer04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121602020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID DUF1931 Motif Other DBs NCBI-GeneID:  121602020 NCBI-ProteinID:  XP_041786728 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcatcatgaacagtttcgtcaacgatatcttcgaacgcattgctgctgaggcgtcc cgcttggcgcactacaacaaacgttcgacgatcacgtcccgcgaaatccaaaccgctgtt cgtctgctgctgcctggtgagcttgccaagcacgccgtctccgaaggaacgaaggctgtc acaaagtacaccagctcgaagtaa

DBGET integrated database retrieval system