Alteromonas mediterranea 615: I633_19635 Help Entry I633_19635        CDS       T02719                                  Name (GenBank) cyd operon protein YbgTEB3   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism amh  Alteromonas mediterranea 615 Pathway amh00190   Oxidative phosphorylation amh01100   Metabolic pathways amh02020   Two-component system Module amh_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:amh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     I633_19635  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     I633_19635 Enzymes [BR:amh01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      I633_19635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGP79485 UniProt:  S5AHT8 LinkDB All DBs Position complement(4015112..4015225) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGVLLACSFGIINAMWLEATENMDRPEDQE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcttggatattaggtgttttactggcgtgctctttcggcattattaat gcgatgtggttggaagcaacggaaaacatggatagacccgaagaccaagagtag

DBGET integrated database retrieval system