KEGG   Actinosynnema mirum: Amir_1996
Entry
Amir_1996         CDS       T00957                                 
Name
(GenBank) aminotransferase class-III
  KO
K20435  validone 7-phosphate aminotransferase [EC:2.6.1.-]
Organism
ami  Actinosynnema mirum
Pathway
ami00525  Acarbose and validamycin biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    Amir_1996
Enzymes [BR:ami01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     Amir_1996
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: ACU35944
UniProt: C6WFK9
LinkDB
Position
complement(2210124..2211428)
AA seq 434 aa
MTAHGTRPGDLGQESARQGSQAAHDAAYYGLGDALLVRGEGVRVWDESGREYLDCVSGTF
NLVLGHNHPEVVAAVKRQADELVFASSSFQTAPTNRVLELLAELAPNGLDRVNLRSAGGS
TANEGAIKMAQWHTGKRDVVVPFRGHLGQTIATASYNGTSRMREPFPYHLPGAVRVPDAY
CHRCFYGKTPDSCGLWCVDRIEDFLRYASSGSVAAMVVEPISGVGGNIVPPPGYLARLRE
FCTERGIVLVFDENQTGLGRTGSVFAADHFGVTPDVITVSKGLTGSGLPLAAIITTEELV
GMPRSMHGFTYGGHTLSAAAAVVTLEIVRRPEFLAHVREAGSVLLERLRALEHPALDEVR
GVGLMLGVELAEPDGSRSPRLATALQERLAARGVVTRVSEHGEGNVIELRPPLVLSVEDA
HLVADRFGEALDGL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaccgcgcacggcaccaggcccggcgacctcggccaggagagcgcccggcagggcagc
caggccgcgcacgacgccgcctactacggcctcggcgacgcgctgctggtgcgcggcgag
ggcgtgcgggtgtgggacgagtcggggcgcgagtacctggactgcgtgtccggcacgttc
aacctcgtgctggggcacaaccaccccgaggtggtggcggcggtcaagcggcaggccgac
gagctggtgttcgccagctcctcgttccagaccgcgccgaccaaccgggtgctggagctg
ctcgcggagctggcgccgaacgggctggaccgggtcaacctgcgcagcgcgggcgggtcc
accgccaacgagggcgccatcaagatggcccagtggcacaccggcaagcgcgacgtggtg
gtgccgttccggggccacctcggccagaccatcgcgaccgccagctacaacgggacctcg
cggatgcgcgagccgttcccgtaccacctgccgggcgcggtgcgggtgccggacgcctac
tgccaccggtgcttctacggcaagacgccggactcgtgcgggctgtggtgcgtggaccgg
atcgaggacttcctgcgctacgcctcctccgggagcgtggcggcgatggtggtcgagccg
atcagcggggtgggcgggaacatcgtgccgccgccggggtacctggcgcggctgcgggag
ttctgcaccgagcgcgggatcgtgctggtgttcgacgagaaccagaccgggctcgggcgc
accggcagcgtgttcgccgccgaccacttcggcgtcaccccggacgtgatcaccgtgtcg
aaggggctgaccggcagcgggctgccgctcgcggcgatcatcaccaccgaggagctggtg
gggatgccgcgctcgatgcacgggttcacctacggcgggcacacgctgtccgccgcggcg
gccgtcgtgacgctggagatcgtgcggcggccggagttcctggcgcacgtgcgggaggcc
gggtcggtgctgctggagcggttgcgggcgctggagcacccggcgctggacgaggtgcgc
ggggtcgggctgatgctcggggtggagctggccgagccggacgggtcgcgctcgccgagg
ctggcgaccgcgctgcaggagcggttggccgcgcgcggggtggtgaccagggtgtccgag
cacggcgagggcaacgtgatcgagctgcgaccgccgctggtgctgagcgtcgaggacgcg
cacctggtcgccgaccggttcggagaggcgttggacgggctgtga

DBGET integrated database retrieval system