KEGG   Actinosynnema mirum: Amir_4587
Entry
Amir_4587         CDS       T00957                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K19104  isonocardicin synthase [EC:2.5.1.38]
Organism
ami  Actinosynnema mirum
Pathway
ami00261  Monobactam biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Module
ami_M00736  Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Amir_4587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ami01008]
    Amir_4587
Enzymes [BR:ami01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.38  isonocardicin synthase
     Amir_4587
Polyketide biosynthesis proteins [BR:ami01008]
 Nonribosomal peptide tailoring proteins
  Others
   Amir_4587
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_2 Methyltransf_31 FtsJ
Other DBs
NCBI-ProteinID: ACU38420
UniProt: C6WLM7
LinkDB
Position
complement(5435237..5436142)
AA seq 301 aa
MTALSRVSGQAPDRVVETYAEGKPYDLFFLDVAGVRLVGRKTEAAYPGPDRDGLPAERLK
CALVEARMLLGVVERDQVAEDHVAVFHRPLGEAEKAELFAAAVADPTTDLYYPYAQLGDR
VRETEEGGWEVTDESARELDHAEEVLRDHVPDRLAELGFRGGVAYDAACSTGAFLQAVGR
RFPGTRTIGQDLSPAMVARARTRLDEAHCGDGIRPAIPEASADLVVCRHLNAFVVGTGQA
HDLLAAAASRCREGGLVVLLGHTPVLVSSQWCEMSGLTPLQRSGATPSGHALFQCYVLRK
G
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgaccgcgctgtcacgcgtgtccgggcaggccccggaccgggtcgtggagacctacgcc
gagggcaagccgtacgacctgttcttcctggacgtggcgggcgtgcgcctggtcggtcgc
aagaccgaggccgcctaccccggccccgaccgggacggcctgcccgccgagcggctcaag
tgcgcgctcgtcgaggcgcggatgctgctgggggtggtggagcgcgaccaggtggccgag
gaccacgtggccgtgttccaccgcccgctgggcgaggcggagaaggccgagctgttcgcc
gcggccgtcgccgaccccacgacggacctgtactacccgtacgcccagctcggcgaccgc
gtccgcgagaccgaggagggcggctgggaggtgaccgacgagtcggcccgcgagctggac
cacgccgaggaggtcctgcgcgaccacgtgccggaccggctcgcggagctggggttccgg
ggcggggtcgcctacgacgccgcctgctcgaccggcgcgttcctccaggccgtcggccgc
cggttccccggcacccgcaccatcgggcaggacctcagccccgccatggtggcccgcgcg
cggaccaggctcgacgaggcgcactgcggcgacggcatccggcccgcgatcccggaggcc
agcgccgacctggtggtgtgcaggcacctcaacgcgttcgtggtcggcaccggccaggcc
cacgacctgctcgccgccgcggcgagcaggtgccgggagggcggcctcgtcgtgctgctc
ggccacaccccggtcctggtcagcagccagtggtgcgagatgtccgggctgaccccgctc
cagcgctcgggagccaccccgtccgggcacgccctgttccagtgctacgtgctgcgcaag
gggtga

DBGET integrated database retrieval system