Actinosynnema mirum: Amir_4593 Help Entry Amir_4593         CDS       T00957                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ami  Actinosynnema mirum Pathway ami00261   Monobactam biosynthesis ami01100   Metabolic pathways ami01110   Biosynthesis of secondary metabolites Module ami_M00736   Nocardicin A biosynthesis, L-pHPG + arginine + serine => nocardicin A Brite KEGG Orthology (KO) [BR:ami00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Amir_4593  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ami01008]     Amir_4593 Polyketide biosynthesis proteins [BR:ami01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Amir_4593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACU38426 UniProt:  C6WLN3 LinkDB All DBs Position 5456801..5457022 Genome browser AA seq 73 aa AA seqDB search MLGENEDSGEFEVVVNHEEQYSIWPADRAVPDGWRTAGQRGAKRACLEWIDANWTDMRPL SLREALRGAGDRA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgctgggagagaacgaggattccggcgaattcgaggtcgtcgtcaaccacgaggagcag tactcgatctggcccgccgaccgggcggtcccggacggctggcggaccgccgggcagcgc ggcgccaagcgggcctgcctggagtggatcgacgcgaactggaccgacatgcgcccgctg agcctgcgcgaggcgctgcgcggggccggggaccgggcttga

DBGET integrated database retrieval system