Actinosynnema mirum: Amir_4651 Help Entry Amir_4651         CDS       T00957                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ami  Actinosynnema mirum Pathway ami00998   Biosynthesis of various antibiotics ami01100   Metabolic pathways ami01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ami00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Amir_4651    00074 Mycolic acid biosynthesis     Amir_4651   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Amir_4651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACU38483 UniProt:  C6WMX0 LinkDB All DBs Position 5538818..5539066 Genome browser AA seq 82 aa AA seqDB search MTIQKITEDAAAERVALVWERALKVSPVAHDADFLSLGGNSLLLLSIITEVEDVFDVELD VDELVEDLTVAGMARVVARTAG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccatccagaagatcaccgaggacgccgcggccgagcgggtcgcgctggtgtgggag cgcgcgctgaaggtgtcgccggtcgcgcacgacgcggacttcctgagcctgggcgggaac tccctgctgctgctgtccatcatcaccgaggtcgaggacgtgttcgacgtcgagctggac gtggacgagctcgtggaggacctgaccgtggcgggcatggcgcgggtggtcgccaggacc gccggatga

DBGET integrated database retrieval system