Actinosynnema mirum: Amir_4861 Help Entry Amir_4861         CDS       T00957                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ami  Actinosynnema mirum Pathway ami00998   Biosynthesis of various antibiotics ami01100   Metabolic pathways ami01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ami00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Amir_4861    00074 Mycolic acid biosynthesis     Amir_4861   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Amir_4861 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACU38687 UniProt:  C6WQJ7 LinkDB All DBs Position 5789149..5789406 Genome browser AA seq 85 aa AA seqDB search MTSNDVLERISAIVAEVGVLPVGEVAPEKFFADDLDIDSLGMVEISATVEDSLGVSIPDE ELAELATVGALVDYVSARAVTAAAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaacgacgtgctcgagcggatcagcgccatcgtcgccgaggtgggcgtgctg ccggtgggcgaggtggcgccggagaagttcttcgcagacgacctcgacatcgactcgctc ggcatggtggagatcagcgcgacggtggaggactcgctcggggtctcgatcccggacgag gagctggccgagctggcgacggtgggcgcgctggtggactacgtgtcggccagagcggtg acggccgcggccgggtga

DBGET integrated database retrieval system