Acropora millepora: 114960221 Help Entry 114960221         CDS       T06134                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism amil  Acropora millepora Pathway amil04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:amil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114960221  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amil04121]     114960221    03400 DNA repair and recombination proteins [BR:amil03400]     114960221 Ubiquitin system [BR:amil04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114960221    Cul5 complex      114960221 DNA repair and recombination proteins [BR:amil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114960221 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_4 Rad60-SLD_2 Crinkler Motif Other DBs NCBI-GeneID:  114960221 NCBI-ProteinID:  XP_029194357 LinkDB All DBs Position 14 Genome browser AA seq 116 aa AA seqDB search MEIFVMVRREKTTIFLDCKEATTVYELKKMVEGITKKAPDDQRLYKDDQILDDAKTLEDC GFTTQTAKAQSPALISLSFRGEDGEFEPVVIAPLSTPPELPDVMKPQDSIPGGDGS NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggagatttttgtgatggtgcgtcgtgaaaagacgaccattttccttgattgcaaggaa gccactactgtctacgaactaaagaaaatggtcgaaggaataacaaagaaggctcctgac gatcagagattgtacaaggatgatcaaatactcgatgatgcgaaaacgctggaggattgc ggctttacaacccaaactgccaaggcacaatccccggctttaattagcttgtcatttaga ggggaagatggagagtttgaaccagtggtcattgcacctctgtctacccctccagaatta cctgatgtcatgaagccccaagatagcattcctggtggtgacggatcgtga

DBGET integrated database retrieval system