Advenella mimigardefordensis: MIM_c40370 Help Entry MIM_c40370        CDS       T03016                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism amim  Advenella mimigardefordensis Pathway amim01100   Metabolic pathways amim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MIM_c40370    00074 Mycolic acid biosynthesis     MIM_c40370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MIM_c40370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  AHG66088 UniProt:  W0PM55 LinkDB All DBs Position 4645581..4645832 Genome browser AA seq 83 aa AA seqDB search MNPSDHIYQTLKTALVELFDIEPERIRPDADLYTDLNIDSIDAIDLIDHIKRVTGHKLLA EDFRNVRKVQDVVDAVSRKLTTA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacccatcagaccacatctatcagacgctcaagaccgcactggtggaactgtttgac attgaacccgagcgtatccggcctgatgccgatctgtacactgatctgaacatcgacagc atcgacgctatcgatctgattgatcatatcaagcgtgtcaccggccacaagctgctggca gaagatttccgtaatgtacgcaaggtgcaggatgtcgttgatgccgtaagccgcaagctg accacggcataa

DBGET integrated database retrieval system