Aminobacter sp. NyZ550: N7E70_018635 Help Entry N7E70_018635      CDS       T11159                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism amio  Aminobacter sp. NyZ550 Pathway amio02024   Quorum sensing amio03018   RNA degradation Brite KEGG Orthology (KO) [BR:amio00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     N7E70_018635 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     N7E70_018635 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:amio03019]     N7E70_018635 (hfq)    03036 Chromosome and associated proteins [BR:amio03036]     N7E70_018635 (hfq) Messenger RNA biogenesis [BR:amio03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      N7E70_018635 (hfq) Chromosome and associated proteins [BR:amio03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     N7E70_018635 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  WAX93690 LinkDB All DBs Position complement(3748932..3749177) Genome browser AA seq 81 aa AA seqDB search MAERSQNLQDLFLNSVRKSKNPLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFDGEESQGG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgatcgcagaatcttcaggatcttttcctgaattcagttcgcaagagcaaa aacccactcaccattttcctgattaacggcgtgaagttgaccggagtagtgacctccttc gacaatttctgtgttttgttgcgccgtgacgggcactcgcagctcgtctacaagcatgcc atctccacgatcatgccgagccagccggttcagatgttcgatggcgaggaaagccagggc ggctga

DBGET integrated database retrieval system