Anarhichas minor (spotted wolffish): 142941571 Help Entry 142941571         CDS       T11660                                  Symbol lnc.lemp Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism amir  Anarhichas minor (spotted wolffish) Brite KEGG Orthology (KO) [BR:amir00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:amir03029]     142941571 (lnc.lemp) Mitochondrial biogenesis [BR:amir03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     142941571 (lnc.lemp) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom SPC12 Motif Other DBs NCBI-GeneID:  142941571 NCBI-ProteinID:  XP_075939647 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MAELSERTLQVAVVASFAAGFVAGWQANRMRRKFLDWRKKRLQDKLSETQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggctgaactctcggagaggacgctgcaagtcgccgtcgtggcctccttcgccgccggc tttgtggcgggctggcaggcgaacagaatgaggaggaagtttctggactggaggaagaag cggctgcaagacaagctgtcagaaactcagaagaagctcgatttggcttga

DBGET integrated database retrieval system