Anarhichas minor (spotted wolffish): 142947329 Help Entry 142947329         CDS       T11660                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism amir  Anarhichas minor (spotted wolffish) Pathway amir04010   MAPK signaling pathway amir04012   ErbB signaling pathway amir04068   FoxO signaling pathway amir04137   Mitophagy - animal amir04140   Autophagy - animal amir04144   Endocytosis amir04150   mTOR signaling pathway amir04210   Apoptosis amir04218   Cellular senescence amir04370   VEGF signaling pathway amir04371   Apelin signaling pathway amir04510   Focal adhesion amir04519   Cadherin signaling amir04540   Gap junction amir04625   C-type lectin receptor signaling pathway amir04810   Regulation of actin cytoskeleton amir04910   Insulin signaling pathway amir04912   GnRH signaling pathway amir04916   Melanogenesis amir05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amir00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     142947329    04012 ErbB signaling pathway     142947329    04370 VEGF signaling pathway     142947329    04371 Apelin signaling pathway     142947329    04068 FoxO signaling pathway     142947329    04150 mTOR signaling pathway     142947329   09133 Signaling molecules and interaction    04519 Cadherin signaling     142947329  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     142947329    04140 Autophagy - animal     142947329    04137 Mitophagy - animal     142947329   09143 Cell growth and death    04210 Apoptosis     142947329    04218 Cellular senescence     142947329   09144 Cellular community - eukaryotes    04510 Focal adhesion     142947329    04540 Gap junction     142947329   09142 Cell motility    04810 Regulation of actin cytoskeleton     142947329  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     142947329   09152 Endocrine system    04910 Insulin signaling pathway     142947329    04912 GnRH signaling pathway     142947329    04916 Melanogenesis     142947329  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142947329  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:amir04131]     142947329   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amir04147]     142947329    04031 GTP-binding proteins [BR:amir04031]     142947329 Membrane trafficking [BR:amir04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     142947329  Endocytosis   Macropinocytosis    Ras GTPases     142947329 Exosome [BR:amir04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    142947329   Exosomal proteins of colorectal cancer cells    142947329 GTP-binding proteins [BR:amir04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     142947329 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Motif Other DBs NCBI-GeneID:  142947329 NCBI-ProteinID:  XP_075944957 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac cggaaacaggttgtgatcgacggggagacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatt aaacgtgtgaaggactcagacgacgttccaatggtgcttgtgggaaacaaatgtgacctc ccgtcacgcacggtggacacgaggcaagcccaggaactcgcccgctcttacggcatccct tacatcgagacctctgccaaaacacgacagggagtagaggacgccttctacacgctggtt agagagatcagacagcataagctgaggaagctgaacccgccggacgagagcggtcaggac tgtatgagctgtcgctgtgtggtgtcgtga

DBGET integrated database retrieval system