Anarhichas minor (spotted wolffish): 142960117 Help Entry 142960117         CDS       T11660                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism amir  Anarhichas minor (spotted wolffish) Pathway amir04145   Phagocytosis amir04517   IgSF CAM signaling amir04814   Motor proteins amir05132   Salmonella infection Brite KEGG Orthology (KO) [BR:amir00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     142960117 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     142960117 (dynll2b)   09142 Cell motility    04814 Motor proteins     142960117 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142960117 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:amir03037]     142960117 (dynll2b)    04812 Cytoskeleton proteins [BR:amir04812]     142960117 (dynll2b) Cilium and associated proteins [BR:amir03037]  Motile cilia and associated proteins   Dynein arm    142960117 (dynll2b) Cytoskeleton proteins [BR:amir04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      142960117 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  142960117 NCBI-ProteinID:  XP_075957858 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MTEKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgagaagaaggctgtgataaagaatgcagacatgtctgatgaaatgcagcaggat gcagtggactgtgccatgcaggctatggagaagtacaacattgaaaaggacattgccgcc tatgtcaaaaaggagtttgacaagaagtacaaccccacatggcattgcattgtcgggaga aacttcggcagctacgtgacgcacgagacgaagcacttcatctacttctacctgggccag gtggccattctactgttcaagtcgggctga

DBGET integrated database retrieval system