Ailuropoda melanoleuca (giant panda): 100463597 Help Entry 100463597         CDS       T01329                                  Name (RefSeq) nucleoside diphosphate kinase B   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml00230   Purine metabolism aml00240   Pyrimidine metabolism aml00983   Drug metabolism - other enzymes aml01100   Metabolic pathways aml01232   Nucleotide metabolism aml01240   Biosynthesis of cofactors Module aml_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP aml_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP aml_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP aml_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP aml_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:aml00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     100463597    00240 Pyrimidine metabolism     100463597   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     100463597  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100463597 Enzymes [BR:aml01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      100463597 Membrane trafficking [BR:aml04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     100463597 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  100463597 NCBI-ProteinID:  XP_034496471 LinkDB All DBs Position 13:complement(20109053..20111425) Genome browser AA seq 85 aa AA seqDB search MNSGPVVAMVWEGLNVVKTGRMMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAE KEISLWFKPEELVHYKSCAFDWIYE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaactccgggccggttgtggccatggtctgggagggactgaatgtggtcaagacgggg agaatgatgcttggggagaccaacccagcggattcgaagccaggcaccattcgtggggac ttctgcattcaagttggcaggaacatcattcatggcagtgattcagtaaaaagtgcagag aaagaaatcagcctatggtttaagcctgaagagctggtccactacaagtcttgtgctttt gactggatctatgaataa

DBGET integrated database retrieval system