Ailuropoda melanoleuca (giant panda): 100464006 Help Entry 100464006         CDS       T01329                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04062   Chemokine signaling pathway aml04620   Toll-like receptor signaling pathway aml05142   Chagas disease aml05163   Human cytomegalovirus infection aml05323   Rheumatoid arthritis aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100464006    04061 Viral protein interaction with cytokine and cytokine receptor     100464006  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100464006    04062 Chemokine signaling pathway     100464006  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100464006   09174 Infectious disease: parasitic    05142 Chagas disease     100464006   09163 Immune disease    05323 Rheumatoid arthritis     100464006   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100464006  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100464006    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100464006 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Chemokines    100464006 Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Chemokines    100464006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF7451 CXCL16 Motif Other DBs NCBI-GeneID:  100464006 NCBI-ProteinID:  XP_002923659 Ensembl:  ENSAMEG00000030600 UniProt:  A0A7N5K2E6 LinkDB All DBs Position 13:complement(9827484..9832147) Genome browser AA seq 93 aa AA seqDB search MKVILPLLVFLLILVALHSEANEEPVKLNPTACCFTYTTRKVPLRFVKRYDRTSDQCSTP GVIFLTRHERQICANPNVPWVQEYIRHLDNMSM NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcatcctgcctctcctggtcttcctcctcattcttgttgcccttcactctgag gccaatgaagaaccagttaaattaaaccccactgcgtgctgtttcacctacaccacacgg aaggtcccactccggtttgtgaaacgttatgatagaaccagtgaccagtgctccacccca ggggtcatcttccttacccgacatgaacgacagatctgtgccaaccccaatgttccctgg gtgcaggagtacatcagacacctagacaacatgtctatgtga

DBGET integrated database retrieval system