Entry |
|
Symbol |
SEM1
|
Name |
(RefSeq) 26S proteasome complex subunit SEM1
|
KO |
K10881 | 26 proteasome complex subunit DSS1 |
|
Organism |
aml Ailuropoda melanoleuca (giant panda)
|
Pathway |
aml05022 | Pathways of neurodegeneration - multiple diseases |
|
Brite |
KEGG Orthology (KO) [BR:aml00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
100465742 (SEM1)
09124 Replication and repair
03440 Homologous recombination
100465742 (SEM1)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
100465742 (SEM1)
09164 Neurodegenerative disease
05010 Alzheimer disease
100465742 (SEM1)
05012 Parkinson disease
100465742 (SEM1)
05014 Amyotrophic lateral sclerosis
100465742 (SEM1)
05016 Huntington disease
100465742 (SEM1)
05017 Spinocerebellar ataxia
100465742 (SEM1)
05020 Prion disease
100465742 (SEM1)
05022 Pathways of neurodegeneration - multiple diseases
100465742 (SEM1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:aml03019]
100465742 (SEM1)
04131 Membrane trafficking [BR:aml04131]
100465742 (SEM1)
03051 Proteasome [BR:aml03051]
100465742 (SEM1)
03400 DNA repair and recombination proteins [BR:aml03400]
100465742 (SEM1)
Messenger RNA biogenesis [BR:aml03019]
Eukaryotic type
mRNA surveillance and transport factors
Transport factors
TREX-2 complex
100465742 (SEM1)
Membrane trafficking [BR:aml04131]
Exocytosis
Tethering complex
Exocyst complex assembly proteins
100465742 (SEM1)
Proteasome [BR:aml03051]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
100465742 (SEM1)
DNA repair and recombination proteins [BR:aml03400]
Eukaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
Other HR factors
100465742 (SEM1)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
1:complement(146215026..146240037)
|
AA seq |
70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS |
NT seq |
213 nt +upstreamnt +downstreamnt
atgtcagagaagaagcagccggtagacttgggtctcttggaggaggacgacgagttcgag
gagttccctgccgaagactgggctggtttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttctccaatcagttacgagctgaacta
gagaaacatggttataagatggagacctcatag |