Ailuropoda melanoleuca (giant panda): 100465958 Help Entry 100465958         CDS       T01329                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml03082   ATP-dependent chromatin remodeling aml04217   Necroptosis aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100465958  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100465958  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100465958  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100465958   09165 Substance dependence    05034 Alcoholism     100465958  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100465958   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100465958 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100465958 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100465958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  100465958 NCBI-ProteinID:  XP_034499078 Ensembl:  ENSAMEG00000030369 LinkDB All DBs Position 2:complement(87212735..87213297) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcggaaagcagggaggcaaagctcgcgccaaggccaagtcgcggtcgtcc cgcgctggcctgcagttcccggtgggccgagtgcaccgcctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggccgcggtgctggagtacctgacg gcggaaatcctggagctggcggggaacgcggcccgcgacaacaagaagacgcgcatcatc cctcgccatttgcagctagccgtgagaaatgacgaagagctcaacaagttacttgggggt gtcaccattgcccagggcggcgtcttgcccaatatccaggcggtcttgttgcccaagaaa acggagagtcacaagcctggcaagaacaagtaa

DBGET integrated database retrieval system