Ailuropoda melanoleuca (giant panda): 100466250 Help Entry 100466250         CDS       T01329                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml00480   Glutathione metabolism aml00980   Metabolism of xenobiotics by cytochrome P450 aml00982   Drug metabolism - cytochrome P450 aml00983   Drug metabolism - other enzymes aml01100   Metabolic pathways aml01524   Platinum drug resistance aml05200   Pathways in cancer aml05204   Chemical carcinogenesis - DNA adducts aml05215   Prostate cancer aml05225   Hepatocellular carcinoma aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100466250 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100466250 (GSTP1)    00982 Drug metabolism - cytochrome P450     100466250 (GSTP1)    00983 Drug metabolism - other enzymes     100466250 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100466250 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     100466250 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100466250 (GSTP1)    05215 Prostate cancer     100466250 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100466250 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100466250 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:aml02000]     100466250 (GSTP1) Enzymes [BR:aml01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100466250 (GSTP1) Transporters [BR:aml02000]  Other transporters   Pores ion channels [TC:1]    100466250 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  100466250 NCBI-ProteinID:  XP_034501181 Ensembl:  ENSAMEG00000001020 UniProt:  G1L2H9 LinkDB All DBs Position 16:85969853..86015361 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPTRGRCEAMRMLLADQGQSWKEEVVTKETWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQREAALLDVVNDGVEDLRCKYVMLIYTNYEAGKEEYL KALPGYLKPFETLLSQNEGGQAFIVGNQISFADYNLLDLLLIHQVLAPSCLDSLPLLSAY VARLSARPKLKAFLASPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttccccacccgagggcgctgcgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggttaccaaggagacctggctg cagggcccgctcaaggcctcctgtctctacgggcagctccccaagttccaggatggagac ctcaccctgtaccagtccaatgccatcctgcggcacctgggccgctcccttgggctgtac gggaaggaccagcgggaggcggccctgctggatgtggtgaacgatggtgtggaggacctc cgctgcaaatacgtcatgctcatctacaccaactacgaggcagggaaagaggagtacttg aaggcgctaccggggtacctgaagccctttgagacgctgctgtcgcagaacgagggcggc caggccttcatcgtgggcaaccagatctccttcgcggactacaacttgctggacctgctg ctgattcaccaggtcctggcccccagctgcctggactccttgcccctgctctcggcctat gtggcgcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcacgtg aaccgccccatcaacggcaacgggaagcagtaa

DBGET integrated database retrieval system