Ailuropoda melanoleuca (giant panda): 100466609 Help Entry 100466609         CDS       T01329                                  Symbol CRKL Name (RefSeq) crk-like protein   KO K04438   C-crk adapter molecule crk Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04012   ErbB signaling pathway aml04015   Rap1 signaling pathway aml04062   Chemokine signaling pathway aml04148   Efferocytosis aml04510   Focal adhesion aml04666   Fc gamma R-mediated phagocytosis aml04722   Neurotrophin signaling pathway aml04810   Regulation of actin cytoskeleton aml04910   Insulin signaling pathway aml04935   Growth hormone synthesis, secretion and action aml05100   Bacterial invasion of epithelial cells aml05135   Yersinia infection aml05163   Human cytomegalovirus infection aml05170   Human immunodeficiency virus 1 infection aml05200   Pathways in cancer aml05206   MicroRNAs in cancer aml05211   Renal cell carcinoma aml05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100466609 (CRKL)    04012 ErbB signaling pathway     100466609 (CRKL)    04015 Rap1 signaling pathway     100466609 (CRKL)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100466609 (CRKL)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100466609 (CRKL)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100466609 (CRKL)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100466609 (CRKL)    04062 Chemokine signaling pathway     100466609 (CRKL)   09152 Endocrine system    04910 Insulin signaling pathway     100466609 (CRKL)    04935 Growth hormone synthesis, secretion and action     100466609 (CRKL)   09156 Nervous system    04722 Neurotrophin signaling pathway     100466609 (CRKL)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100466609 (CRKL)    05206 MicroRNAs in cancer     100466609 (CRKL)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100466609 (CRKL)    05211 Renal cell carcinoma     100466609 (CRKL)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100466609 (CRKL)    05163 Human cytomegalovirus infection     100466609 (CRKL)   09171 Infectious disease: bacterial    05135 Yersinia infection     100466609 (CRKL)    05100 Bacterial invasion of epithelial cells     100466609 (CRKL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SH3_2 SH2 SH3_1 SH3_9 hSH3 Motif Other DBs NCBI-GeneID:  100466609 NCBI-ProteinID:  XP_002926331 Ensembl:  ENSAMEG00000024636 UniProt:  D2HUK7 LinkDB All DBs Position 14:complement(44296449..44332868) Genome browser AA seq 303 aa AA seqDB search MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD ENE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgtcctccgccaggttcgactcttcagaccgctccgcttggtacatggggccggtgtct cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctagttcgcgat tcctccacctgccccggggattatgtgctgtccgtgtcggagaactcgcgggtctcccac tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccac ttgccggccctgctggagttctacaagatccactacctggacaccaccaccctaatcgag cccgcgcccaggtacccgagcccaccaatgggatctgtatcagcacccaacctgcctaca gcagaagaaaatctggaatatgtacggactctctatgattttcctgggaatgatgctgaa gacctgccctttaaaaagggtgagatcctggtgataatagagaagcctgaagaacagtgg tggagcgcccggaacaaggatggccggattgggatgattcctgttccttatgttgaaaag cttgtgagatcctcaccacatggaaagcacgggaataggaattccaacagttatgggatc ccagaacctgctcatgcgtatgcccaacctcagaccacaactcctctacctgcagtttcc agtactcctggggcagcaatcaaccctttgccatccacacagaatggacctgtctttgca aaagccatccagaaaagagtaccctgtgcttatgacaagaccgccttggcattagaggtt ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaat gggcgcaaagggcttttcccctttacgcatgtcaaaatcattgaccctcaaaaccctgat gaaaacgagtga

DBGET integrated database retrieval system